Online life science pharma marketplace and platform for products and services.

 

Submit informationCurrent location: Home » Sell » Protein research »

Human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF)

Click to zoom out
Product/service: recombinant protein 
Unit Price:   Inquiry 
Minimum quantity:    
Supply ability:
Delievery time: Within 3 days upon receipt of payment
Valid through: Not expired
Last update on: 2021-02-12
View times: 0
Company details
  • Creative BioMart-
  • ContactLinna Green   
  •    Not registered
  • email  
  • Tel  
  • Location  USA
  • Address  45-1 Ramsey Road , Shirley, New York 11967
 
 
Product details

 
Cat#:  THP-0003
Product Name:  Human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF)
Description:  The product is a human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.
Formula:  C639H1006N168O196S8
Sequences:  APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Species:  Human
Source:  Yeast
CAS No. :  123774-72-1
Molecular Weight:  14434.5 Da
Synonyms:  GM-CSF
https://www.creativebiomart.net/therapeutic-proteins/p/2/tuberculin-purified-protein-derivative-ppd/
Total 0  Comments

 
More..More products from this company

[ SellSearch ]  [ ]  [ Tell a friend ]  [ Print ]  [ Close window ]  [ Return to top ]